Mouse Anti-D. melanogaster Frg1 Antibody (CBMOAB-16975FYA)


Cat: CBMOAB-16975FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO16975FYA
SpecificityThis antibody binds to fruit fly Frg1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene maps to a location 100 kb centromeric of the repeat units on chromosome 4q35 which are deleted in facioscapulohumeral muscular dystrophy (FSHD). It is evolutionarily conserved and has related sequences on multiple human chromosomes but DNA sequence analysis did not reveal any homology to known genes. In vivo studies demonstrate the encoded protein is localized to the nucleolus.
Product OverviewMouse Anti-D. melanogaster Frg1 Antibody is a mouse antibody against Frg1. It can be used for Frg1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein FRG1 homolog; FRG1
UniProt IDQ9VWA8
Protein RefseqThe length of the protein is 262 amino acids long.
The sequence is show below: MSDYDHARIKKLVLKGEKLKKSKKRKKEKDEAGSSKKAKVVVDEDAVKHGGWWAAKTAADITGTVSIEFGDRSYLKAMDNGLFTLGAPHNAGDGPDPEEIFTAFPINDRKVAFKSGYGKYLKIEKDGMVTGRSEAVGGMEQWEPVFEEQRMALLSETGHFMSIDPQDDACVALRKKVGQHEICKVRSNASRDVVIDTEPKEEKGDLGEVEKNYVKKFQKFQDKKMRINQNDVKELEQAKAQGSLHETLLDRRSKMKADRYCK.
For Research Use Only | Not For Clinical Use.
Online Inquiry