AibGenesis™ Mouse Anti-Gasp Antibody (CBMOAB-17267FYA)


Cat: CBMOAB-17267FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-17267FYA Monoclonal Fruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster) WB, ELISA MO17267FYA 100 µg
MO-NAB-00630W Monoclonal D. melanogaster (Drosophila melanogaster) IF, IHC, WB NW0552 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster)
CloneMO17267FYA
SpecificityThis antibody binds to fruit fly Gasp.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Gasp Antibody is a mouse antibody against Gasp. It can be used for Gasp detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGasp, isoform A; LD05259p; Gasp
UniProt IDQ9VNL0
Protein RefseqThe length of the protein is 258 amino acids long.
The sequence is show below: MKKFLVVFVALFGAAVAQSSFKCPDDFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDCGDRTELEPPITTPHCSRLYGIFPDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQVPECKNEEVANGFSCPAAGELANAGSFSRHAHPEDCRKYYICLEGVAREYGCPIGTVFKIGDSDGTGNCEDPEDVPGCEDYYGDLDLKSIRKSELLAGLNSEGRTKGAPKTKAASSSS.
For Research Use Only | Not For Clinical Use.
Online Inquiry