AibGenesis™ Mouse Anti-Gstd2 Antibody (CBMOAB-18272FYA)


Cat: CBMOAB-18272FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-18272FYA Monoclonal Fruit fly (Drosophila melanogaster), A. aegpti (Aedes aegpti) WB, ELISA MO18272FYA 100 µg
MO-AB-05900Y Monoclonal A. aegpti (Aedes aegpti) WB, ELISA MO05900Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. aegpti (Aedes aegpti)
CloneMO18272FYA
SpecificityThis antibody binds to fruit fly Gstd2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionConjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles (PubMed:22082028). May be involved in detoxification (PubMed:22082028). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Gstd2 Antibody is a mouse antibody against Gstd2. It can be used for Gstd2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlutathione S-transferase D2; DmGST21; EC 2.5.1.18; GstD2; gstD21
UniProt IDQ9VG98
Protein RefseqThe length of the protein is 215 amino acids long.
The sequence is show below: MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDLKRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKYSNVSRWYDNAKKVTPGWDENWEGLMAMKALFDARKLAAK.
For Research Use Only | Not For Clinical Use.
Online Inquiry