Mouse Anti-D. melanogaster Gstt2 Antibody (CBMOAB-18314FYA)


Cat: CBMOAB-18314FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO18314FYA
SpecificityThis antibody binds to fruit fly Gstt2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene, glutathione S-transferase (GST) theta 2 (GSTT2), is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1, GSTT2, and GSTT2B. GSTT2 and GSTT2B are nearly identical to each other, and share 55% amino acid identity with GSTT1. All three genes may play a role in human carcinogenesis. The GSTT2 gene is a pseudogene in some populations.
Product OverviewMouse Anti-D. melanogaster Gstt2 Antibody is a mouse antibody against Gstt2. It can be used for Gstt2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG30005; GstT2
UniProt IDA1Z7X7
Protein RefseqThe length of the protein is 228 amino acids long.
The sequence is show below: MSKPIRFYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKPKPEQIQALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPKVVKWLERVRVSANPYHDEGLTFIDRKSKQSTAAKL.
For Research Use Only | Not For Clinical Use.
Online Inquiry