Mouse Anti-Hsp22 Antibody (CBMOAB-20813FYA)


Cat: CBMOAB-20813FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-20813FYA Monoclonal Fruit fly (Drosophila melanogaster), Maize (Zea mays) WB, ELISA MO20813FYA 100 µg
MO-AB-48442W Monoclonal Maize (Zea mays) WB, ELISA MO48442W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Maize (Zea mays)
CloneMO20813FYA
SpecificityThis antibody binds to fruit fly Hsp22.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Hsp22 Antibody is a mouse antibody against Hsp22. It can be used for Hsp22 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHeat shock protein 22; Hsp22
UniProt IDP02515
Protein RefseqThe length of the protein is 174 amino acids long.
The sequence is show below: MRSLPMFWRMAEEMARMPRLSSPFHAFFHEPPVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDYSELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLKEREVTIEQTGEPAKKSAEEPNDKAASQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry