AibGenesis™ Mouse Anti-D. melanogaster Lolal Antibody (CBMOAB-23162FYA)


Cat: CBMOAB-23162FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO23162FYA
SpecificityThis antibody binds to fruit fly Lolal.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRequired, together with Trl, for maintaining the repressed state of target genes including homeotic genes Scr and Ubx. May also be involved in the activation of homeotic genes. Binds to a DNA Polycomb response element (PRE) at the bithorax complex. Also binds to polytene chromosomes at several hundred sites, many of which are shared with Trl and ph-p. Required during embryonic development. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Lolal Antibody is a mouse antibody against Lolal. It can be used for Lolal detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLongitudinals lacking protein-like; Lola-like protein; Protein Batman; lolal; ban
UniProt IDQ7KRI2
Protein RefseqThe length of the protein is 127 amino acids long.
The sequence is show below: MMSSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPSKHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETPSSIKREG.
For Research Use Only | Not For Clinical Use.
Online Inquiry