Mouse Anti-D. melanogaster Med6 Antibody (CBMOAB-23592FYA)


Cat: CBMOAB-23592FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO23592FYA
SpecificityThis antibody binds to fruit fly Med6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMED6 (Mediator Complex Subunit 6) is a Protein Coding gene. Among its related pathways are Gene Expression and Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha). Gene Ontology (GO) annotations related to this gene include transcription factor binding and RNA polymerase II transcription cofactor activity.
Product OverviewMouse Anti-D. melanogaster Med6 Antibody is a mouse antibody against Med6. It can be used for Med6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMediator of RNA polymerase II transcription subunit 6; Mediator complex subunit 6; dMED6; MED6
UniProt IDQ8MSX2
Protein RefseqThe length of the protein is 249 amino acids long.
The sequence is show below: MASRQMTNDHLRLSWHDTQMMATLSPQTVMDYFCRKSNPFYDHMCNNETVRMQRLGPEHLHNMIGLEYILLHVAEPILYVIRKQHRHNPSEATPIADYYIIGGTVYKAPDLANVINSRILNTVVNLQSAFEEASSYARYHPNKGYTWDFSSNKVFSDRSKSDKKDANSAKDENSGTLFQKQRVDMLLAELLRKFPPPIPPMLQNLQQPPPAGDDLNTARNASEMNNATGPLDIKTEGVDMKPPPEKKSK.
For Research Use Only | Not For Clinical Use.
Online Inquiry