Mouse Anti-D. melanogaster Med7 Antibody (CBMOAB-23593FYA)


Cat: CBMOAB-23593FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO23593FYA
SpecificityThis antibody binds to fruit fly Med7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene.
Product OverviewMouse Anti-D. melanogaster Med7 Antibody is a mouse antibody against Med7. It can be used for Med7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRE06169p; Med7
UniProt IDQ8SZC6
Protein RefseqThe length of the protein is 563 amino acids long.
The sequence is show below: MSEKNIKTAIPEKSKGLENDKDADGNSDSTAEAEATPTEEGSATFDKAIEGAGFGIFNLMLLIVSIPAQSAAIFESSSMSYILPIAECDLRLTLEDKGVLNAVAYAGMTISAIAWGYLADTKGRKKILYWGYLIDAVCVFGSALSQNFSMLVMFKFLGGLVVNGPAAVLFTYLTEMHGPKHRSSVLMIVGMVTSTATVSLPLLAWGIFPRDWDFEFWGLQVHSWQIFLFVLGIPSLISGLIFCSMPESPRFLMAQGRNEEALQAFKQIYHVNTRKPKDSYPIKALIQEVPNRKAAQNEVIYTIEEKSGEVPTKRQSRTLAESLRAGLQQMKPLVRKPLLGLAICCYVMQFGIFLGMNTIRLWLPQLFASMAEYEALHAGDGLDVSMCTILEFSVNQTAETALNYADACSEPKVISMDMYLNNIIVSATGFVGHFFAGGILRALGPKRMMTYGLFLSGTFGLMLYFSVSSLMTLIVSATFLTITGIAVSSLLGAVVALFPTQLRTVVVAIAMMCGRFGALSGNLLFPVFVQTGCLPPFIMVSSVLILSGILSISLPDPAKATFS.
For Research Use Only | Not For Clinical Use.
Online Inquiry