AibGenesis™ Mouse Anti-Mkp3 Antibody (CBMOAB-24343FYA)


Cat: CBMOAB-24343FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-24343FYA Monoclonal Fruit fly (Drosophila melanogaster), Chicken (Gallus gallus) WB, ELISA MO24343FYA 100 µg
MO-AB-02918Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02918Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Chicken (Gallus gallus)
CloneMO24343FYA
SpecificityThis antibody binds to fruit fly Mkp3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Mkp3 Antibody is a mouse antibody against Mkp3. It can be used for Mkp3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMitogen-activated protein kinase phosphatase 3, isoform C; EC 3.1.3.-; EC 3.1.3.41; Mkp3
UniProt IDM9PG13
Protein RefseqThe length of the protein is 497 amino acids long.
The sequence is show below: MPETEHETCSKEWLQSQLRSLDSKDLILLDCRGSHEYSESHIRGAVNLCIPSIVLRRLAVGKIDLASTIKSPELKQRIQSGYKLCWFILYNGEGVPGQNQEIAGAGSLAVAMDSIISILHRRLKQDGCRVVALQDGFNNFRQAFPEWCEDDNQTHSKEIESSRNVQTDQLMGLRSLRISTTQSDSACSSSAESSDCESSSHHHHHHSHHNYNEAPVEIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKESGDIKYLQIPITDHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFHFMQQLLSFESQLRLRPGSRFSCSCIAPDCNCMQTTGFMATHLANATGVSPDSGIEFDRWTPSDTGLKXEQSGGKSFVLPPSQEVPFAAAATSPLPMCLAVNPDNMSPASTTSSSTSTTTTAEAVSVVEMVQHRDQEMAEEDIITRGEYDEDAA.
For Research Use Only | Not For Clinical Use.
Online Inquiry