Mouse Anti-D. melanogaster Mt:Cyt-B Antibody (CBMOAB-24961FYA)


Cat: CBMOAB-24961FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO24961FYA
SpecificityThis antibody binds to fruit fly Mt:Cyt-B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) that is part of the mitochondrial respiratory chain. The b-c1 complex mediates electron transfer from ubiquinol to cytochrome c. Contributes to the generation of a proton gradient across the mitochondrial membrane that is then used for ATP synthesis. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Mt:Cyt-B Antibody is a mouse antibody against Mt:Cyt-B. It can be used for Mt:Cyt-B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome b; mt:Cyt-b; cob CYTB Cytb cytb
UniProt IDQ9ME01
Protein RefseqThe length of the protein is 378 amino acids long.
The sequence is show below: MNKPLRNSHPLFKIANNALVDLPAPINISSWWNFGSLLGLCLIIQILTGLFLAMHYTADINLAFYSVNHICRDVNYGWLLRTLHANGASFFFICIYLHVGRGIYYGSYKFTPTWLIGVIILFLVMGTAFMGYVLPWGQMSFWGATVITNLLSAIPYLGMDLVQWLWGGFAVDNATLTRFFTFHFILPFIVLAMTMIHLLFLHQTGSNNPIGLNSNIDKIPFHPYFTFKDIVGFIVMIFILISLVLISPNLLGDPDNFIPANPLVTPAHIQPEWYFLFAYAILRSIPNKLGGVIALVLSIAILMILPFYNLSKFRGIQFYPINQVMFWSMLVTVILLTWIGARPVEEPYVLIGQILTVVYFLYYLVNPLITKWWDNLLN.
For Research Use Only | Not For Clinical Use.
Online Inquiry