AibGenesis™ Mouse Anti-D. melanogaster Mttf Antibody (CBMOAB-25089FYA)


Cat: CBMOAB-25089FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO25089FYA
SpecificityThis antibody binds to fruit fly Mttf.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTranscription termination factor (PubMed:12626700, PubMed:15845400, PubMed:16648357). Binds promoter DNA and regulates mitochondrial replication and transcription (PubMed:12626700, PubMed:15845400, PubMed:16648357, PubMed:24068965). Transcription termination activity may be polarized with highest termination activity occurring when its DNA-binding site is positioned in the reverse orientation with respect to the incoming RNA polymerase (PubMed:15845400). Required for normal topology and maintenance of mitochondrial DNA (mtDNA) levels (PubMed:24068965). Regulates mtDNA replication by promoting replication pausing, possibly by acting as a natural barrier to replication fork progression (PubMed:24068965). Its function in replication pausing prevents unregulated replication that may occur for example by collisions between the machineries of DNA replication and transcription during mtDNA synthesis (PubMed:24068965). This ensures the incorporation of RNA transcripts into replication intermediates at the replication fork and allow for proper fork progression (PubMed:24068965). Shares mtDNA binding sites with the mitochondrial termination factor mTerf5 and thereby may antagonize mTerf5 function during replication to regulate pausing (PubMed:22784680, PubMed:24068965). Likely to function downstream of Dref which activates genes involved in mtDNA replication and maintenance (PubMed:19032147, PubMed:24068965). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Mttf Antibody is a mouse antibody against Mttf. It can be used for Mttf detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAT17625p; Mitochondrial transcription termination factor; mTTF; BG:DS01068.4
UniProt IDQ9V3F3
Protein RefseqThe length of the protein is 410 amino acids long.
The sequence is show below: MIRSLLRSFETALKLHAGLNMHPMHCSRRLLFSQYENRASPSRLTSSGTLGSNEAENDYVPYRQDRETGTKTRVLLEALRERFRFTDAELQKIISDELVHRCYRGRSLTLVMDTLQLEGVSRRSFVEYPWLLSLDNKRLELKMQLLKSMDFKDINHFVPFLRLTVPRLRKLVGALNSERDAMPQRNRVYYISEKLDVSPDIVSKYLSKRLFILEMPFEMFEKNLQHMIDYNVSPINVLKDLWAFRYTPKSVQLRLERAKRAKKDKIMPWMVRCPEPILQRSLKLSLDELKVLGEFSSVVEYLAHRLGFSTSEAKAIMDKHPQVHTVRVTKIKEVLDYLLDEAQFTRFEVAQNPRILCHSLKTTKERMEELKSHGCRPSSLVILCRSRREYDKFLQNWISHERNPQSVSEG.
For Research Use Only | Not For Clinical Use.
Online Inquiry