Mouse Anti-D. melanogaster Nsmce1 Antibody (CBMOAB-25813FYA)


Cat: CBMOAB-25813FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO25813FYA
SpecificityThis antibody binds to fruit fly Nsmce1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRING-type zinc finger-containing E3 ubiquitin ligase that assembles with melanoma antigen protein (MAGE) to catalyze the direct transfer of ubiquitin from E2 ubiquitin-conjugating enzyme to a specific substrate. Within MAGE-RING ubiquitin ligase complex, MAGE stimulates and specifies ubiquitin ligase activity likely through recruitment and/or stabilization of the E2 ubiquitin-conjugating enzyme at the E3:substrate complex. Involved in maintenance of genome integrity, DNA damage response and DNA repair. NSMCE3/MAGEG1 and NSMCE1 ubiquitin ligase are components of SMC5-SMC6 complex and may positively regulate homologous recombination-mediated DNA repair. MAGEF1-NSMCE1 ubiquitin ligase promotes proteasomal degradation of MMS19, a key component of the cytosolic iron-sulfur protein assembly (CIA) machinery. Down-regulation of MMS19 impairs the activity of several DNA repair and metabolism enzymes such as ERCC2/XPD, FANCJ, RTEL1 and POLD1 that require iron-sulfur clusters as cofactors.
Product OverviewMouse Anti-D. melanogaster Nsmce1 Antibody is a mouse antibody against Nsmce1. It can be used for Nsmce1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNon-structural maintenance of chromosomes element 1 homolog; Non-SMC element 1 homolog
UniProt IDQ9VMA0
Protein RefseqThe length of the protein is 235 amino acids long.
The sequence is show below: MELVKRGFLRACKNHSYLSFELIDDILAPLCANHKTTKPGSKEAIRALVAEINDTISDLGQLLVFIKYPVKAEEYLVYAKTDATPDSVANTGLTAEECQYFSKLLDKIASEEDCHIAWNDAYNDIVLQASSKPLKKSRMQELLQKWIQMGYFMEVTDRIYLGPRSLVELSFYLSSNHADNIKNCTLCKCLVLWDIRCGSCNIQYHRGCIQTYLQRRDICPSCGNLWTTPIRRSIG.
For Research Use Only | Not For Clinical Use.
Online Inquiry