AibGenesis™ Mouse Anti-Obp83A Antibody (CBMOAB-26291FYA)


Cat: CBMOAB-26291FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-26291FYA Monoclonal Fruit fly (Drosophila melanogaster), A. aegpti (Aedes aegpti) WB, ELISA MO26291FYA 100 µg
Inquiry
MO-AB-05129Y Monoclonal A. aegpti (Aedes aegpti) WB, ELISA MO05129Y 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. aegpti (Aedes aegpti)
CloneMO26291FYA
SpecificityThis antibody binds to fruit fly Obp83A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Obp83A Antibody is a mouse antibody against Obp83A. It can be used for Obp83A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGeneral odorant-binding protein 83a; Odorant-binding protein 83a; Odorant-binding protein OS-F; Pheromone-binding protein-related protein 3; PBPRP-3; Obp83a; OS-F Pbprp3
UniProt IDP54193
Protein RefseqThe length of the protein is 154 amino acids long.
The sequence is show below: MALNGFGRRVSASVLLIALSLLSGALILPPAAAQRDENYPPPGILKMAKPFHDACVEKTGVTEAAIKEFSDGEIHEDEKLKCYMNCFFHEIEVVDDNGDVHLEKLFATVPLSMRDKLMEMSKGCVHPEGDTLCHKAWWFHQCWKKADPKHYFLP.
For Research Use Only | Not For Clinical Use.
Online Inquiry