AibGenesis™ Mouse Anti-Pdh Antibody (CBMOAB-27382FYA)


Cat: CBMOAB-27382FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-27382FYA Monoclonal Fruit fly (Drosophila melanogaster), Cucumber (Cucumis sativus), Medaka (Oryzias latipes), Soybean (Glycine max), Tomato (Lycopersicon esculentum) WB, ELISA MO27382FYA 100 µg
MO-AB-01277R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01277R 100 µg
MO-AB-28572W Monoclonal Cucumber (Cucumis sativus) WB, ELISA MO28572W 100 µg
MO-AB-32165H Monoclonal Soybean (Glycine max) WB, ELISA MO32165C 100 µg
MO-AB-34996H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO34996C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cucumber (Cucumis sativus), Medaka (Oryzias latipes), Soybean (Glycine max), Tomato (Lycopersicon esculentum)
CloneMO27382FYA
SpecificityThis antibody binds to fruit fly Pdh.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Pdh Antibody is a mouse antibody against Pdh. It can be used for Pdh detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHL08057p; IP03491p; Photoreceptor dehydrogenase, isoform A; EC 1.1.1.1; EC 1.1.1.105; Pdh
UniProt IDQ9VV42
Protein RefseqThe length of the protein is 278 amino acids long.
The sequence is show below: MKPQGIPPTTTRISQTKMSFRGKNAVVTGGAGGIGLQVSKQLLAAGAAKVAIIDLQDNLEEFVKLRAAHPTQSVMIIKMDVANKKGVEATYEEIAKTFGNIDIVVNVAGIFNDKDVQRTLLVNLGGIINSTLSALPYMGKDNGGKGGIVVNMSSVVGLDPMFIIPVYGATKAGIINFTRCLANEKYYQRSGIKFVTVCPGATMTDMFTNFTEKIIFPETSDETYRILDRLNKQSAADVSRCILNVLEKDKNGAVYVIEGKRVYPLEIKPQWTGKEQAL.
For Research Use Only | Not For Clinical Use.
Online Inquiry