AibGenesis™ Mouse Anti-Pgap2 Antibody (CBMOAB-28043FYA)


Cat: CBMOAB-28043FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-28043FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Hamsters (Cricetinae), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO28043FYA 100 µg
CBMOAB-54347FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO54347FYA 100 µg
CBMOAB-92310FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92310FYA 100 µg
MO-AB-17816R Monoclonal Cattle (Bos taurus) WB, ELISA MO17816R 100 µg
MO-AB-26745W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26745W 100 µg
MO-AB-27837H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27837C 100 µg
MO-AB-43354W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43354W 100 µg
MO-AB-61363W Monoclonal Marmoset WB, ELISA MO61363W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Hamsters (Cricetinae), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO28043FYA
SpecificityThis antibody binds to fruit fly Pgap2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene plays a role in the maturation of glycosylphosphatidylinositol (GPI) anchors on GPI-anchored proteins. Mutations in this gene are associated with an autosomal recessive syndrome characterized by hyperphosphatasia and intellectual disability. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Pgap2 Antibody is a mouse antibody against Pgap2. It can be used for Pgap2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPost-GPI attachment to proteins factor 2
UniProt IDQ9VPT7
Protein RefseqThe length of the protein is 255 amino acids long.
The sequence is show below: MLPTYERFSDPKSVLFRLPFARLALVALSLPLGGFFFCVIWSLTFDFVRSTYTHCDVTNYLPSVSAAIGNYEPQKTVWRLAIFLHLPLRLAVAKIYLEHYREHIRRSRRLLGILACFLNVVEDLALFCLSFWTSADHYETHRNAFVVFIACSECYMLVSYLLNRNIQKTVLLPHEEKSLRYKRNLFLVNVIAFGLAGYCFVRHNSHCEAGVYTFFALFEYIVVLTNMGFHMTSYWDFYALNVVCDAKHGLYLSQS.
For Research Use Only | Not For Clinical Use.
Online Inquiry