Mouse Anti-D. melanogaster Pis Antibody (CBMOAB-27771FYA)


Cat: CBMOAB-27771FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO27771FYA
SpecificityThis antibody binds to fruit fly Pis.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Golgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCatalyzes the biosynthesis of phosphatidylinositol (PtdIns) as well as PtdIns:inositol exchange reaction (PubMed:17151285, PubMed:24828534, PubMed:24603715). May thus act to reduce an excessive cellular PtdIns content (By similarity). The exchange activity is due to the reverse reaction of PtdIns synthase and is dependent on CMP, which is tightly bound to the enzyme (By similarity). Required for the regeneration of the signaling molecule phosphatidylinositol 4,5-bisphosphate (PtdInsP2) from phosphatidic acid (PA) and maintenance of its steady supply during signaling, thus playing an essential role during phospholipase C-mediated transduction (PubMed:17151285). This function is essential in photoreceptors for light-activated recycling of PtdInsP2 during phototransduction (PubMed:17151285). As a key enzyme of the phosphoinositide pathway, indirectly involved in the polarized secretion of basal membrane (BM) proteins in follicle epithelial (FE) cells through promoting PtdInsP2 synthesis in the apical and lateral plasma membranes of FE cells (PubMed:24828534). PtdInsP2 controls the localization of Crag and perhaps the localization and expression of strat, both of which are essential for restricting the secretion of BM proteins to the basal surface (PubMed:24828534, PubMed:28228250).
Product OverviewMouse Anti-D. melanogaster Pis Antibody is a mouse antibody against Pis. It can be used for Pis detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPhosphatidylinositol synthase, isoform A; EC 2.7.8.11; RE35104p; Pis
UniProt IDQ8SX37
Protein RefseqThe length of the protein is 224 amino acids long.
The sequence is show below: MTIAEHDNVFIFVPNLIGYARIVLALIAFWFMSTNYVISGWCYVTSALLDAVDGQAARAFNQSTRFGAMLDQLTDRCGTTGLLVTLAYFYPRYMFWFQLSIAIDVACHWLFMQTSVVVGRSSHKVNDNFIMRLYYQKDILTFMCCVNELFYVCLYLLHFTYGPLIFGASLFKILAFLTGPFAVLKALISVMHAYVAGIDLAAVDVRERQERRQKSEPVSGKKVE.
For Research Use Only | Not For Clinical Use.
Online Inquiry