AibGenesis™ Mouse Anti-Sap47 Antibody (CBMOAB-30329FYA)


Cat: CBMOAB-30329FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-30329FYA Monoclonal Fruit fly (Drosophila melanogaster), Ant, D. melanogaster (Drosophila melanogaster), Fish, Insects, Mosquito WB, ELISA MO30329FYA 100 µg
MO-AB-03061W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO03061W 100 µg
MO-NAB-00771W Monoclonal Ant, D. melanogaster (Drosophila melanogaster), Fish, Insects, Mosquito IF, IHC, WB NW0693 100 µg
MO-NAB-00772W Monoclonal D. melanogaster (Drosophila melanogaster) IHC, IP, WB NW0694 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Ant, D. melanogaster (Drosophila melanogaster), Fish, Insects, Mosquito
CloneMO30329FYA
SpecificityThis antibody binds to fruit fly Sap47.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Sap47 Antibody is a mouse antibody against Sap47. It can be used for Sap47 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSynapse-associated protein of 47 kDa; Sap47
UniProt IDQ960T2
Protein RefseqThe length of the protein is 551 amino acids long.
The sequence is show below: MFSGLTNQFTSLVGAVKGGAGDEDVPAPTGDAPAAAPAASTSVEATASSAVDPEAAAAAGGEGLEGEEAGKRLPKSASLVDSLVSEATGWLGSAKGWLGNASIPSMPAMPSMPSMPAMPAMPSIPSIPGLRKGAGADGAEGAEGAVAGEGGAAASGAVSGGEDDDKSRYISATEGADSHPASGGGTPTGDEGQIGQGKGDEVKITTKVTQQAKHFGSFLSSAISKAGSKIKETVKDNTILDSFNKEQEAFIKGQGGVGNGAAPWIGHANEAKIKEEILGLSQDRRNFVRAPPAGVDFEFSYDTAYPTAIAIMAEDKALETMRFELVPKIITEENFWRNYFYRVSLIIQAAELGTLGADGVGQASSGEDANEVATKEKKSKTAEPAKGDSSVKAIAEQPKAVIEPEAQECDVQAAKSKAKAKAQAGKELGQKISESEFVSDDFQASSESDLAEIQDGMRKLGIDSMTQQALAATDEEQWEKDLEAELKDYEVVDEGGTGGDGGGGRRKGRKAGEDDTEADEDEPTISNLRTRSTNNDWEEYADLIEDTDDLK.
For Research Use Only | Not For Clinical Use.
Online Inquiry