AibGenesis™ Mouse Anti-Sdhaf3 Antibody (CBMOAB-30665FYA)


Cat: CBMOAB-30665FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-30665FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO30665FYA 100 µg
MO-AB-19857R Monoclonal Cattle (Bos taurus) WB, ELISA MO19857R 100 µg
MO-AB-21489W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21489W 100 µg
MO-AB-28888H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28888C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO30665FYA
SpecificityThis antibody binds to fruit fly Sdhaf3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPlays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Promotes maturation of the iron-sulfur protein subunit SdhB of the SDH catalytic dimer, protecting it from the deleterious effects of oxidants. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Sdhaf3 Antibody is a mouse antibody against Sdhaf3. It can be used for Sdhaf3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSuccinate dehydrogenase assembly factor 3, mitochondrial; SDH assembly factor 3; SDHAF3; Sdhaf3
UniProt IDQ8SZ16
Protein RefseqThe length of the protein is 120 amino acids long.
The sequence is show below: MSRILMSQLTHPQRVRLLYKTILRLHRGLPAELRALGDNYVRDEFRRHLKCNPMEAQLFMTEWARYASTITQQLGIRGKPKGELGEEIDPKTVEMLKDDQVVQLYELMLAAKGVEDAQGK.
For Research Use Only | Not For Clinical Use.
Online Inquiry