AibGenesis™ Mouse Anti-Sifa Antibody (CBMOAB-31059FYA)


Cat: CBMOAB-31059FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-31059FYA Monoclonal Fruit fly (Drosophila melanogaster), Silkworm (Bombyx mori) WB, ELISA MO31059FYA 100 µg
MO-AB-70408W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO70408W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Silkworm (Bombyx mori)
CloneMO31059FYA
SpecificityThis antibody binds to fruit fly Sifa.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Sifa Antibody is a mouse antibody against Sifa. It can be used for Sifa detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIFamide; SIFa; IFa
UniProt IDQ59E62
Protein RefseqThe length of the protein is 163 amino acids long.
The sequence is show below: MALRFTLTLLLVTILVAAILLGSSEAAYRKPPFNGSIFGKRNSLGKSKIRIPLKPPPISPSRLRQRQNERRLRGGHGGVSHVVSPERQQIGPRPATPPPRTDLEPTTNTPATGGQMLCLLVRLNVEMPDVKKVMYKIYNVSRAYRYIELMPYIYIKYSINLQH.
For Research Use Only | Not For Clinical Use.
Online Inquiry