Mouse Anti-D. melanogaster Smc4 Antibody (CBMOAB-31310FYA)


Cat: CBMOAB-31310FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO31310FYA
SpecificityThis antibody binds to fruit fly Smc4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the 'structural maintenance of chromosomes' (SMC) gene family. Members of this gene family play a role in two changes in chromosome structure during mitotic segregation of chromosomes- chromosome condensation and sister chromatid cohesion. The protein encoded by this gene is likely a subunit of the 13S condensin complex, which is involved in chromosome condensation. A pseudogene related to this gene is located on chromosome 2.
Product OverviewMouse Anti-D. melanogaster Smc4 Antibody is a mouse antibody against Smc4. It can be used for Smc4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names88-82 truncated gluon; SMC4
UniProt IDQ867M1
Protein RefseqThe length of the protein is 122 amino acids long.
The sequence is show below: MQKARPSKGTPKAAGGARQSGQFRVPQLTAQQQLRAQQQQEEEDAAVDALDDALIFDDEEGGTRIGDIYIPPPVPPHCSMESTGPRLIISKIVNRNFKSYAGEVELGPFHQSFTAIIGPMMK.
For Research Use Only | Not For Clinical Use.
Online Inquiry