Mouse Anti-D. melanogaster Smt3 Antibody (CBMOAB-31375FYA)
Cat: CBMOAB-31375FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster) |
| Clone | MO31375FYA |
| Specificity | This antibody binds to fruit fly Smt3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The covalent modification of target lysine by SUMO (small ubiquitin-like modifier) can regulate protein localization, transcription, nuclear transport, mitosis, DNA replication and repair, signal transduction, and virus reproduction. SUMO does not seem to be involved in protein degradation, and may actually act as an antagonist of ubiquitin during the degradation process. During the development of Drosophila, SUMO plays a maternal role in front and back (A/P) polarity and patterns. |
| Product Overview | Mouse Anti-D. melanogaster Smt3 Antibody is a mouse antibody against Smt3. It can be used for Smt3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Small ubiquitin-related modifier; SUMO; smt3; Smt3 |
| UniProt ID | O97102 |
| Protein Refseq | The length of the protein is 90 amino acids long. The sequence is show below: MSDEKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGGAP. |
See other products for " Smt3 "
| MOFY-0922-FY62 | Mouse Anti-Smt3 (AA 15-98) Antibody, IgG1 kappa (MOFY-0922-FY62) |
| MO-DKB-03783W | Rabbit Anti-SMT3 Antibody (Cat MO-DKB-03783W) |
| CBMOAB-04052CR | Mouse Anti-Yeast SMT3 Antibody (CBMOAB-04052CR) |
| MO-DKB-03781W | Mouse Anti-SMT3 (Full length, clone ms2109-063) Antibody (Cat MO-DKB-03781W) |
| MOFY-0922-FY64 | Mouse Anti-Smt3 (AA 15-98) Antibody, IgG1 kappa (MOFY-0922-FY64) |
| MO-AB-00924H | Mouse Anti-Arabidopsis SMT3 Antibody (MO-AB-00924H) |
| MO-DKB-03947W | Rabbit Anti-SMT3 (AA 2-98) Antibody (Cat MO-DKB-03947W) |
| CBMOAB-41542FYC | Mouse Anti-Arabidopsis SMT3 Antibody (CBMOAB-41542FYC) |
| MO-AB-36613W | Mouse Anti-French-bean SMT3 Antibody (MO-AB-36613W) |
| MO-MMB-0678 | Anti-smt3 Antibody (Cat MO-MMB-0678), Rabbit IgG |
For Research Use Only | Not For Clinical Use.
Online Inquiry