Mouse Anti-D. melanogaster Snap29 Antibody (CBMOAB-31390FYA)


Cat: CBMOAB-31390FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO31390FYA
SpecificityThis antibody binds to fruit fly Snap29.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene, a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. The protein encoded by this gene binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene.
Product OverviewMouse Anti-D. melanogaster Snap29 Antibody is a mouse antibody against Snap29. It can be used for Snap29 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSynaptosomal-associated protein; Snap29; usnp
UniProt IDQ9W1I8
Protein RefseqThe length of the protein is 284 amino acids long.
The sequence is show below: MAHNYLQPVHDHFDDVDRFEDVDDDLFLQNKRTGAAKLPQQRSTNPFEMDDDDEEEITSSPSVAAQRLAYAEKRRAIEQRTLDSTNKSLGLLYETQEVGKATAVELAKQREQLEKTSHQLDEISSTLRFSQRHLTGLKSVFGGLKNYLSGNRDQPPTATGSPTGSQSSQEANSNINQGACGGASPSAPLSPAERYDNHPVSQLRGDPSSTYQPQRQAANPFQAQIDSNLEEMCSNLSVLKMLATDLGGEIESQNELLDNMNYKIEDVDLKIHKQNKDMSKLLKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry