AibGenesis™ Mouse Anti-So Antibody (CBMOAB-31448FYA)


Cat: CBMOAB-31448FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-31448FYA Monoclonal Fruit fly (Drosophila melanogaster), Drosophila melanogaster, Tomato (Lycopersicon esculentum) WB, ELISA MO31448FYA 100 µg
MO-AB-35301H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO35301C 100 µg
MOFY-1222-FY130 Polyclonal Drosophila melanogaster WB, IHC, ICC, IF, ELISA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Drosophila melanogaster, Tomato (Lycopersicon esculentum)
CloneMO31448FYA
SpecificityThis antibody binds to fruit fly So.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRequired for visual system development. May transcriptionally regulate genes necessary for optic lobe invagination and Bolwig's nerve formation. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster So Antibody is a mouse antibody against So. It can be used for So detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein sine oculis; so
UniProt IDQ27350
Protein RefseqThe length of the protein is 416 amino acids long.
The sequence is show below: MLQHPATDFYDLAAANAAAVLTARHTPPYSPTGLSGSVALHNNNNNNSSTSNNNNSTLDIMAHNGGGAGGGLHLNSSSNGGGGGGVVSGGGSGGRENLPSFGFTQEQVACVCEVLQQAGNIERLGRFLWSLPQCDKLQLNESVLKAKAVVAFHRGQYKELYRLLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAEHKDGSTDKQHLDSSSDSEMEGSMLPSQSAQHQQQQQQQQHSPGNSSGNNNGLHQQQLQHVAAEQGLQHHPHQPHPASNIANVAATKSSGGGGGGGVSAAAAAQMQMPPLTAAVAYSHLHSVMGAMPMTAMYDMGEYQHL.
For Research Use Only | Not For Clinical Use.
Online Inquiry