AibGenesis™ Mouse Anti-Sod Antibody (CBMOAB-31460FYA)


Cat: CBMOAB-31460FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-31460FYA Monoclonal WB, ELISA MO31460FYA 100 µg
MO-AB-28076W Monoclonal Cottonwood (Populus deltoids) WB, ELISA MO28076W 100 µg
MO-AB-28666W Monoclonal Cucumber (Cucumis sativus) WB, ELISA MO28666W 100 µg
MO-AB-35302H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO35302C 100 µg
MO-AB-42617W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42617W 100 µg
MO-DKB-0596RA Polyclonal WB 100 µL
MO-DKB-0597RA Polyclonal Rice (Oryza) WB 50 µL

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cottonwood (Populus deltoids), Cucumber (Cucumis sativus), Guinea pig (Cavia porcellus), Rice (Oryza), Rice (Oryza); A. thaliana (Arabidopsis thaliana), Tomato (Lycopersicon esculentum)
CloneMO31460FYA
SpecificityThis antibody binds to fruit fly Sod.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Sod Antibody is a mouse antibody against Sod. It can be used for Sod detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSuperoxide dismutase [Cu-Zn]; EC 1.15.1.1; Sod
UniProt IDM9PF91
Protein RefseqThe length of the protein is 167 amino acids long.
The sequence is show below: MVVKAVCVINGDAKGTVFFEQEVRIQNHLNFSARQNSSGTPVKVSGEVCGLAKGLHGFHVHEFGDNTNGCMSSGPHFNPYGKEHGAPVDENRHLGDLGNIEATGDCPTKVNITDSKITLFGADSIIGRTVVVHADADDLGQGGHELSKSTGNAGARIGCGVIGIAKV.
For Research Use Only | Not For Clinical Use.
Online Inquiry