Mouse Anti-Tfiia-S Antibody (CBMOAB-32936FYA)


Cat: CBMOAB-32936FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-32936FYA Monoclonal Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana) WB, ELISA MO32936FYA 100 µg
CBMOAB-44951FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO44951FC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana)
CloneMO32936FYA
SpecificityThis antibody binds to fruit fly Tfiia-S.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation (PubMed:7958898). TFIIA in a complex with TBP mediates transcriptional activity (PubMed:7958898). Part of a rhi-dependent transcription machinery that enables the generation of piRNA precursors from heterochromatin while maintaining the suppression of transposon-encoded promoters and enhancers (PubMed:28847004). Forms a complex with Moonshiner/CG12721 and Trf2 which recruit transcriptional machinery to heterochromatin to initiate the bidirectional transcription of piRNA clusters, by interacting with the RDC (rhi, del and cuff) complex that binds to repressive H3K9me3 marks in the chromatin (PubMed:28847004). This mechanism allows transcription to occur in piRNA clusters despite the lack of proper promoter elements and in the presence of the repressive H3K9me3 mark (PubMed:28847004).
Product OverviewMouse Anti-D. melanogaster Tfiia-S Antibody is a mouse antibody against Tfiia-S. It can be used for Tfiia-S detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranscription initiation factor IIA subunit 2; General transcription factor IIA subunit 2; TFIIA p14 subunit; TFIIA-14; Transcription initiation factor IIA gamma chain; TFIIA-gamma; dTFIIA-S; TfIIA-S
UniProt IDP52656
Protein RefseqThe length of the protein is 106 amino acids long.
The sequence is show below: MSYQLYRNTTLGNTLQESLDELIQYGQITPGLAFKVLLQFDKSINNALNQRVKARVTFKAGKLNTYRFCDNVWTLMLNDVEFREVHEIVKVDKVKIVACDGKSGEF.
For Research Use Only | Not For Clinical Use.
Online Inquiry