AibGenesis™ Mouse Anti-D. melanogaster Tim9B Antibody (CBMOAB-33009FYA)


Cat: CBMOAB-33009FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO33009FYA
SpecificityThis antibody binds to fruit fly Tim9B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as the external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70 kDa complex that guides the target proteins in transit through the aqueous mitochondrial intermembrane space. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Tim9B Antibody is a mouse antibody against Tim9B. It can be used for Tim9B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG12788, isoform A; CG12788, isoform C; CG12788, isoform E; SD05444p2; Tim9b; Tim9b-RC
UniProt IDQ9VWF7
Protein RefseqThe length of the protein is 292 amino acids long.
The sequence is show below: MRRICLVALIGLPAAGKSSLCSWLLGQQAALRVRHIVHLCYDDFLDATPSADLAYKEQRGRIFKVIEKLISAIQEDTDWPPQVRRISSSGDYNSGRHLILCDDNFYYRSMRYKLYQLCRDSGCIFGQIYMASSLDSCLQANSLRSDATRVPVDVVRQMNERLEVPDTSEAWERNSLTLNGLDMDTTGSALLAFIASLLDLPAMETTLDLPPAVARGLRQDQSLVHRLDLLLRTRIGALLDGLRQGEDKRLAGQTLNSRRKDILTKFRTEIGGKQIDGDVEGDALDYYVNLLN.
For Research Use Only | Not For Clinical Use.
Online Inquiry