AibGenesis™ Mouse Anti-Wbl Antibody (CBMOAB-34337FYA)


Cat: CBMOAB-34337FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34337FYA Monoclonal Fruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster) WB, ELISA MO34337FYA 100 µg
MO-NAB-00871W Monoclonal D. melanogaster (Drosophila melanogaster) IF, IHC, WB NW0793 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster)
CloneMO34337FYA
SpecificityThis antibody binds to fruit fly Wbl.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Wbl Antibody is a mouse antibody against Wbl. It can be used for Wbl detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein windbeutel; Erp29 homolog; wbl; wind
UniProt IDO44342
Protein RefseqThe length of the protein is 257 amino acids long.
The sequence is show below: MMHILVTLLLVAIHSIPTTWAVTCTGCVDLDELSFEKTVERFPYSVVKFDIAYPYGEKHEAFTAFSKSAHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVDVTLDNLKAFVSANTPLYIGRDGCIKEFNEVLKNYANIPDAEQLKLIEKLQAKQEQLTDPEQQQNARAYLIYMRKIHEVGYDFLEEETKRLLRLKAGKVTEAKKEELLRKLNILEVFRVHKVTKTAPEKEEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry