Mouse Anti-D. melanogaster Wrnexo Antibody (CBMOAB-34425FYA)


Cat: CBMOAB-34425FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO34425FYA
SpecificityThis antibody binds to fruit fly Wrnexo.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionEssential for the formation of DNA replication focal centers (PubMed:18346216, PubMed:18956248). Has an important role in maintaining genome stability (PubMed:18346216, PubMed:18956248). Has exonuclease activity on both single-stranded and duplex templates bearing overhangs, but not blunt ended duplex DNA, and cleaves in a 3''-5'' direction (PubMed:18346216, PubMed:18056975, PubMed:18956248). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Wrnexo Antibody is a mouse antibody against Wrnexo. It can be used for Wrnexo detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesWRN exonuclease, isoform B; WRNexo
UniProt IDE1JIP3
Protein RefseqThe length of the protein is 354 amino acids long.
The sequence is show below: MEKYLTKMPIKSKANEVPKEEAGVKKETPKVARKATKKDTPKELKDKENAGDDNTPKQTKGRPGRPAAKRKNLDTPDVKTEKLAMEEENPPKRRSSRLTRSTRSMAEDGSPSPEKEKPEKLPFIKYKGAIKYFTESQDIAASADDVLQWVEKQKDEVVPMAFDMEWPFSFQTGPGKSAVIQICVDEKCCYIYQLTNVKKLPAALVALINHPKVRLHGVNIKNDFRKLARDFPEVTAEPLIEKCVDLGLWCNEVCETGGRWSLERLTNFIAKKAMDKSKKVRMSKWHVIPLDENQLMYAAIDVYIGQVIYRELERREKVKIKNEEEFKEKNGDAAFKAMKALGETFLTKINEVTL.
For Research Use Only | Not For Clinical Use.
Online Inquiry