Mouse Anti-dad1 Antibody (CBMOAB-72889FYA)
Cat: CBMOAB-72889FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-72889FYA | Monoclonal | Zebrafish (Danio rerio), A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Goat (Capra hircus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rice (Oryza), Yeast | WB, ELISA | MO72889FYA | 100 µg | ||
| CBMOAB-27349FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO27349FC | 100 µg | ||
| CBMOAB-00943CR | Monoclonal | Yeast | WB, ELISA | MO00943CR | 100 µg | ||
| CBMOAB-02474HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO02474HB | 100 µg | ||
| CBMOAB-22474FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO22474FYB | 100 µg | ||
| MO-AB-09039W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09039W | 100 µg | ||
| MO-AB-23278W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23278W | 100 µg | ||
| MO-AB-30100W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30100W | 100 µg | ||
| MO-AB-34650W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34650W | 100 µg | ||
| MO-AB-37106W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO37106W | 100 µg | ||
| MO-AB-44332W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44332W | 100 µg | ||
| MO-AB-53896W | Monoclonal | Marmoset | WB, ELISA | MO53896W | 100 µg | ||
| MO-AB-11166R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11166R | 100 µg | ||
| MO-AB-25272H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25272C | 100 µg | ||
| MO-AB-33014H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33014C | 100 µg | ||
| MO-AB-00338L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00338L | 100 µg | ||
| MO-AB-01545Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO01545Y | 100 µg | ||
| MO-AB-07864Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07864Y | 100 µg | ||
| MO-AB-11202Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11202Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Goat (Capra hircus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rice (Oryza), Yeast |
| Clone | MO72889FYA |
| Specificity | This antibody binds to Zebrafish dad1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Endoplasmic reticulum; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | DAD1, the defender against apoptotic cell death, was initially identified as a negative regulator of programmed cell death in the temperature sensitive tsBN7 cell line. The DAD1 protein disappeared in temperature-sensitive cells following a shift to the nonpermissive temperature, suggesting that loss of the DAD1 protein triggered apoptosis. DAD1 is believed to be a tightly associated subunit of oligosaccharyltransferase both in the intact membrane and in the purified enzyme, thus reflecting the essential nature of N-linked glycosylation in eukaryotes. |
| Product Overview | Mouse Anti-Zebrafish dad1 Antibody is a mouse antibody against dad1. It can be used for dad1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; Oligosaccharyl transferase subunit DAD1; EC 2.4.99.18; dad |
| UniProt ID | A7E2L0 |
| Protein Refseq | The length of the protein is 113 amino acids long. The sequence is show below: MSNSVFSVISRFVEEYRSSTLTKLKVIDAYLLYILLTGVFQFLYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKGDFLTVSPERAFADFLFAHTVLHLVVVNFVG. |
See other products for " DAD1 "
| MO-AB-14911Y | Mouse Anti-DAD1 Antibody (MO-AB-14911Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry