Mouse Anti-DAPP1 Antibody (CBMOAB-40394FYA)


Cat: CBMOAB-40394FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40394FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO40394FYA 100 µg
CBMOAB-72923FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO72923FYA 100 µg
MO-AB-11177R Monoclonal Cattle (Bos taurus) WB, ELISA MO11177R 100 µg
MO-AB-53909W Monoclonal Marmoset WB, ELISA MO53909W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Zebrafish (Danio rerio)
CloneMO40394FYA
SpecificityThis antibody binds to Rhesus DAPP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDAPL1 (Death Associated Protein Like 1) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity.
Product OverviewMouse Anti-Rhesus DAPP1 Antibody is a mouse antibody against DAPP1. It can be used for DAPP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDAPP1
UniProt IDF7GXM7
Protein RefseqThe length of the protein is 281 amino acids long.
The sequence is show below: MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTENDLVPTAPSVSDLQLFNFLDTFKMKTWKTRWFTLHRNELKYYKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLVKDKSWFILSALYISPGEKTEHK.
For Research Use Only | Not For Clinical Use.
Online Inquiry