AibGenesis™ Mouse Anti-DARC Antibody (CBMOAB-40396FYA)


Cat: CBMOAB-40396FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40396FYA Monoclonal Rhesus (Macaca mulatta), Gorilla, Marmoset, Rabbit (Oryctolagus cuniculus) WB, ELISA MO40396FYA 100 µg
MO-AB-01837W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01837W 100 µg
MO-AB-07868Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07868Y 100 µg
MO-AB-38519W Monoclonal Gorilla WB, ELISA MO38519W 100 µg
MO-AB-53911W Monoclonal Marmoset WB, ELISA MO53911W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Gorilla, Marmoset, Rabbit (Oryctolagus cuniculus)
CloneMO40396FYA
SpecificityThis antibody binds to Rhesus DARC.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus DARC Antibody is a mouse antibody against DARC. It can be used for DARC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDuffy antigen/chemokine receptor; DARC
UniProt IDF2X0I5
Protein RefseqThe length of the protein is 336 amino acids long.
The sequence is show below: MGNCLHPAELSPSTQNSSQLNSEDLWNFSYDGNDSFPDVDYDANLEAAAPCHSCNLLDDSALPFFILVSVLGILASGTVLFMFFRPLFHWQLCPGWPVLAQLAVGSALFSIVVPILAPGLGNTRSSALCSLGYCVWYGSAFAQALLLGCHASLGPKLGAGQVPGLTLGLSVGLWGVAALLTLPITLASGASGGLCTPVYSMELKALQATHAVACLAVFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTPGSKS.
For Research Use Only | Not For Clinical Use.
Online Inquiry