Mouse Anti-Dbi Antibody (CBMOAB-14624FYA)
Cat: CBMOAB-14624FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-14624FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO14624FYA | 100 µg | ||
CBMOAB-40420FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO40420FYA | 100 µg | ||
CBMOAB-72963FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO72963FYA | 100 µg | ||
MO-AB-01840W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO01840W | 100 µg | ||
MO-AB-24358W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO24358W | 100 µg | ||
MO-AB-26488W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26488W | 100 µg | ||
MO-AB-30108W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30108W | 100 µg | ||
MO-AB-53927W | Monoclonal | Marmoset | WB, ELISA | MO53927W | 100 µg | ||
MO-AB-11192R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11192R | 100 µg | ||
MO-AB-25303R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25303R | 100 µg | ||
MO-AB-02869H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02869C | 100 µg | ||
MO-AB-23123H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23123C | 100 µg | ||
MO-AB-25282H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25282C | 100 µg | ||
MO-AB-01552Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO01552Y | 100 µg | ||
MO-AB-07869Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07869Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
Clone | MO14624FYA |
Specificity | This antibody binds to fruit fly Dbi. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. |
Product Overview | Mouse Anti-D. melanogaster Dbi Antibody is a mouse antibody against Dbi. It can be used for Dbi detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Acyl-CoA-binding protein homolog; ACBP; Diazepam-binding inhibitor homolog; DBI; Dbi |
UniProt ID | P42281 |
Protein Refseq | The length of the protein is 86 amino acids long. The sequence is show below: MVSEQFNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAKPGLLDLKGKAKWEAWNKQKGKSSEAAQQEYITFVEGLVAKYA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry