Mouse Anti-Dbi Antibody (CBMOAB-14624FYA)


Cat: CBMOAB-14624FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-14624FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO14624FYA 100 µg
CBMOAB-40420FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO40420FYA 100 µg
CBMOAB-72963FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO72963FYA 100 µg
MO-AB-01840W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01840W 100 µg
MO-AB-24358W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24358W 100 µg
MO-AB-26488W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26488W 100 µg
MO-AB-30108W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30108W 100 µg
MO-AB-53927W Monoclonal Marmoset WB, ELISA MO53927W 100 µg
MO-AB-11192R Monoclonal Cattle (Bos taurus) WB, ELISA MO11192R 100 µg
MO-AB-25303R Monoclonal Pig (Sus scrofa) WB, ELISA MO25303R 100 µg
MO-AB-02869H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02869C 100 µg
MO-AB-23123H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23123C 100 µg
MO-AB-25282H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25282C 100 µg
MO-AB-01552Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01552Y 100 µg
MO-AB-07869Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07869Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO14624FYA
SpecificityThis antibody binds to fruit fly Dbi.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene.
Product OverviewMouse Anti-D. melanogaster Dbi Antibody is a mouse antibody against Dbi. It can be used for Dbi detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAcyl-CoA-binding protein homolog; ACBP; Diazepam-binding inhibitor homolog; DBI; Dbi
UniProt IDP42281
Protein RefseqThe length of the protein is 86 amino acids long.
The sequence is show below: MVSEQFNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAKPGLLDLKGKAKWEAWNKQKGKSSEAAQQEYITFVEGLVAKYA.
For Research Use Only | Not For Clinical Use.
Online Inquiry