AibGenesis™ Mouse Anti-DCBLD1 Antibody (CBMOAB-40455FYA)


Cat: CBMOAB-40455FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40455FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Zebrafish (Danio rerio) WB, ELISA MO40455FYA 100 µg
CBMOAB-73011FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO73011FYA 100 µg
MO-AB-02880H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02880C 100 µg
MO-AB-26232W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26232W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Zebrafish (Danio rerio)
CloneMO40455FYA
SpecificityThis antibody binds to Rhesus DCBLD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus DCBLD1 Antibody is a mouse antibody against DCBLD1. It can be used for DCBLD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDCBLD1
UniProt IDF6TGP3
Protein RefseqThe length of the protein is 461 amino acids long.
The sequence is show below: GDGCGHLVTYQDSGTMTSKNYPGTYPNHTVCEKTITVPKGKRLILRLGDLDIESQTCASDYLLFTSSSDQYGPYCGSMTVPRELLLNTSEVTVRFESGSHISGRGFLLTYASSDHPDLITCLERASHYLKTEYSKFCPAGCRDVAGDISGNMVDGYRDTSLLCKAAIHAGIIADELGGQISVLQRKGISRYEGILANGVLSRDGSLSDKRFLFTSNGCSRSLSLDPDGQIRASSSWQSVNESGDQVHWSPGQARLQDQGPSWASGDSSSNHKPREWLEIDLGEKKKITGIRTTGSTQSNFNFYVKSFVMNFKNNNSKWKTYKGIVNNEEKVFQGNSNFRDPVQNNFIPPIVARYVRVVPQTWHQRIALKVELIGCQITQGNDSLVWRKTSQSTSVSSKKEDETITRPVPSEETSPGINITTVALPLVLLVVLVFAGMGIFAAFRKKKKKGSPYGSAEAQKT.
For Research Use Only | Not For Clinical Use.
Online Inquiry