Mouse Anti-DCBLD2 Antibody (CBMOAB-40458FYA)


Cat: CBMOAB-40458FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40458FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO40458FYA 100 µg
CBMOAB-73014FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO73014FYA 100 µg
MO-AB-13774W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13774W 100 µg
MO-AB-53959W Monoclonal Marmoset WB, ELISA MO53959W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO40458FYA
SpecificityThis antibody binds to Rhesus DCBLD2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDCBLD2 (Discoidin, CUB And LCCL Domain Containing 2) is a Protein Coding gene. Diseases associated with DCBLD2 include X-Linked Nonsyndromic Deafness. Among its related pathways are Neuroscience. An important paralog of this gene is F8.
Product OverviewMouse Anti-Rhesus DCBLD2 Antibody is a mouse antibody against DCBLD2. It can be used for DCBLD2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDiscoidin, CUB and LCCL domain-containing protein 2; DCBLD2
UniProt IDI0FFQ6
Protein RefseqThe length of the protein is 775 amino acids long.
The sequence is show below: MASRAVVRARRCPQCPQVRAAAAAPAWAALPLSRSLPPCSNSSSSSMPLFLLLLLVLLLLLDDAGAQQGDGCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNEITLLFMSGIHVSGRGFLASYSVIDKQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQENSWKPEKARLKKPGPPWAAFATDEYQWLQIDLNKEKKITGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKVFQGNKDYHQDVRNNFLPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTTPPKIAKGRAPKFTQPLQPRSSNEFPAQTEQTTASPDIKNTTVTPNVTKDVALAAVLVPVLVMVLTTLILILVCAWHWRNRKKKTEGTYDLPYWDRAGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQAGSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPSASAGLPSTSTFKATGNQPPPLVGTYNTLLSRTDSCSSAQAQYDTPKGGKPGPPAPDELVYQVPQSTQEVSGAGRDGECDVFKETL.
For Research Use Only | Not For Clinical Use.
Online Inquiry