AibGenesis™ Mouse Anti-DCTN5 Antibody (CBMOAB-40504FYA)


Cat: CBMOAB-40504FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40504FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO40504FYA 100 µg
CBMOAB-73091FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO73091FYA 100 µg
MO-AB-11238R Monoclonal Cattle (Bos taurus) WB, ELISA MO11238R 100 µg
MO-AB-16258W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16258W 100 µg
MO-AB-25303H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25303C 100 µg
MO-AB-44345W Monoclonal Horse (Equus caballus) WB, ELISA MO44345W 100 µg
MO-AB-53995W Monoclonal Marmoset WB, ELISA MO53995W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO40504FYA
SpecificityThis antibody binds to Rhesus DCTN5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a subunit of dynactin, a component of the cytoplasmic dynein motor machinery involved in minus-end-directed transport. The encoded protein is a component of the pointed-end subcomplex and is thought to bind membranous cargo. A pseudogene of this gene is located on the long arm of chromosome 1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus DCTN5 Antibody is a mouse antibody against DCTN5. It can be used for DCTN5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDCTN5
UniProt IDF7HSC3
Protein RefseqThe length of the protein is 144 amino acids long.
The sequence is show below: QTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV.
For Research Use Only | Not For Clinical Use.
Online Inquiry