Mouse Anti-DDHD2 Antibody (CBMOAB-40526FYA)


Cat: CBMOAB-40526FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40526FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO40526FYA 100 µg
CBMOAB-73131FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO73131FYA 100 µg
MO-AB-11263R Monoclonal Cattle (Bos taurus) WB, ELISA MO11263R 100 µg
MO-AB-24801W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24801W 100 µg
MO-AB-54012W Monoclonal Marmoset WB, ELISA MO54012W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO40526FYA
SpecificityThis antibody binds to Rhesus DDHD2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytoskeleton; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a phospholipase enzyme containing sterile-alpha-motif (SAM), WWE, and DDHD domains. This protein participates in membrane trafficking between the endoplastic reticulum and the Golgi body. Mutations in this gene can cause autosomal recessive spastic paraplegia 54. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Rhesus DDHD2 Antibody is a mouse antibody against DDHD2. It can be used for DDHD2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDDHD2
UniProt IDF6Q0H4
Protein RefseqThe length of the protein is 385 amino acids long.
The sequence is show below: MNRIYTLFLQRNPDFKGGVSIAGHSLGSLILFDILTNQKDSLGDIDSEKDSLNIVMDQGDTPTLEEDLKKLQLSEFFDIFEKEKVDKEALALCTDRDLQEMGIPLGPRKKILNYFSTRKNATGINRPTLQPASGANIPKESEFCSSSNTRNGDYLDVGIGQVSVKYPRLIYKPEIFFAFGSPIGMFLTVRGLKRIDPNYRFPTCKGFFNIYHPFDPVAYRIEPMVVPGVEFEPMLIPHHKGRKRMHLELREGLTRMSMDLKNNLLGSLRMAWKSFTRAPYPALQVSEAAEETEAEPESTSEKPSDVNPEETSVADKEEVLPINVGMLNGGQRIDYVLQEKPIESFNEYLFALQSHLCYWESEDTVLLVLKEIYQTQGIFLDQPLQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry