Mouse Anti-DEFB1 Antibody (MO-AB-30123W)
Cat: MO-AB-30123W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-30123W | Monoclonal | Dog (Canis lupus familiaris), Cattle (Bos taurus), Goat (Capra hircus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) | WB, ELISA | MO30123W | 100 µg | ||
| MO-AB-37116W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO37116W | 100 µg | ||
| MO-AB-54074W | Monoclonal | Marmoset | WB, ELISA | MO54074W | 100 µg | ||
| MO-AB-11330R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11330R | 100 µg | ||
| MO-AB-25337R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25337R | 100 µg | ||
| MO-AB-25336H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25336C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Dog (Canis lupus familiaris), Cattle (Bos taurus), Goat (Capra hircus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) |
| Clone | MO30123W |
| Specificity | This antibody binds to Dog DEFB1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. |
| Product Overview | Mouse Anti-Dog DEFB1 Antibody is a mouse antibody against DEFB1. It can be used for DEFB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Beta-defensin 1; CBD1; DEFB1 |
| UniProt ID | Q30KV2 |
| Protein Refseq | The length of the protein is 69 amino acids long. The sequence is show below: MRPLYLLLLLLCLLFSYLPPGAGFLTGIGQRSDQYICARKGGTCNFSPCPLFTRIDGTCYRGKAKCCMP. |
See other products for " DEFb1 "
| MOFY-0722-FY284 | Rabbit Anti-DEFb1 Antibody (MOFY-0722-FY284) |
For Research Use Only | Not For Clinical Use.
Online Inquiry