AibGenesis™ Mouse Anti-DEFB126 Antibody (MO-AB-19504W)


Cat: MO-AB-19504W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-19504W Monoclonal Chimpanzee (Pan troglodytes), Goat (Capra hircus), Horse (Equus caballus), Marmoset WB, ELISA MO19504W 100 µg
MO-AB-37121W Monoclonal Goat (Capra hircus) WB, ELISA MO37121W 100 µg
MO-AB-44401W Monoclonal Horse (Equus caballus) WB, ELISA MO44401W 100 µg
MO-AB-54084W Monoclonal Marmoset WB, ELISA MO54084W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Goat (Capra hircus), Horse (Equus caballus), Marmoset
CloneMO19504W
SpecificityThis antibody binds to Chimpanzee DEFB126.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDefensins are cysteine-rich cationic polypeptides that are important in the immunologic response to invading microorganisms. The antimicrobial protein encoded by this gene is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 20p13. The encoded protein is highly similar to an epididymal-specific secretory protein (ESP13.2) from cynomolgus monkey. Mutation of this gene is associated with impaired sperm function. (From NCBI)
Product OverviewMouse Anti-Chimpanzee DEFB126 Antibody is a mouse antibody against DEFB126. It can be used for DEFB126 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBeta-defensin 126; Defensin, beta 126; DEFB126
UniProt IDH2QJS2
Protein RefseqThe length of the protein is 108 amino acids long.
The sequence is show below: MKSLLFTLAVFMLLAQLVSGNWYVKKCLNDVGICKKKCKPGEMHIKNGWATCGKQRDCCVPADRRANYPAFCVQTKTTRTSTVTARTTLMVTTASMSSMAPTPVSPTG.
For Research Use Only | Not For Clinical Use.
Online Inquiry