Mouse Anti-dexi Antibody (CBMOAB-73372FYA)
Cat: CBMOAB-73372FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-73372FYA | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Rat (Rattus norvegicus) | WB, ELISA | MO73372FYA | 100 µg | ||
MO-AB-11378R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11378R | 100 µg | ||
MO-AB-25389H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25389C | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Rat (Rattus norvegicus) |
Clone | MO73372FYA |
Specificity | This antibody binds to Zebrafish dexi. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-Zebrafish dexi Antibody is a mouse antibody against dexi. It can be used for dexi detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Dexamethasone-induced protein homolog; dex |
UniProt ID | Q6AXJ3 |
Protein Refseq | The length of the protein is 89 amino acids long. The sequence is show below: MTNSVYFQLDSVESLIDELPYMYYLGLFFVNVLILYYAFLMEYIVLNVGIVFLPEDMDQALVDLGVLSDPASIPYDTDTELDVFEGYLE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry