AibGenesis™ Mouse Anti-DFNB59 Antibody (CBMOAB-40686FYA)


Cat: CBMOAB-40686FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40686FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO40686FYA 100 µg
CBMOAB-73386FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO73386FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO40686FYA
SpecificityThis antibody binds to Rhesus DFNB59.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus DFNB59 Antibody is a mouse antibody against DFNB59. It can be used for DFNB59 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDFNB59
UniProt IDF7FQW3
Protein RefseqThe length of the protein is 88 amino acids long.
The sequence is show below: MFAAATKSFVKQVGDGGRLVPVPSLSEADKYQPLSLVVKKKRCFLFPRYKFTSTPFTLKDILLGDREISAGKFKCLGVPTHSSVLLVT.
For Research Use Only | Not For Clinical Use.
Online Inquiry