Mouse Anti-Dhfr Antibody (CBMOAB-14800FYA)


Cat: CBMOAB-14800FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-14800FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Yeast, Malaria parasite, Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO14800FYA 100 µg
CBMOAB-40725FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO40725FYA 100 µg
CBMOAB-73438FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO73438FYA 100 µg
MO-AB-01588Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01588Y 100 µg
MO-AB-02971H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02971C 100 µg
MO-AB-11412R Monoclonal Cattle (Bos taurus) WB, ELISA MO11412R 100 µg
MO-AB-11857H Monoclonal Malaria parasite WB, ELISA MO11857C 100 µg
MO-AB-25394H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25394C 100 µg
MO-AB-26051W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26051W 100 µg
MO-AB-43070W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43070W 100 µg
MO-AB-54170W Monoclonal Marmoset WB, ELISA MO54170W 100 µg
MO-NAB-00241W Monoclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Yeast WB, ELISA, IF, S-ELISA 2B10 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Yeast, Malaria parasite, Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO14800FYA
SpecificityThis antibody binds to fruit fly Dhfr.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDihydrofolate reductase converts dihydrofolate into tetrahydrofolate, a methyl group shuttle required for the de novo synthesis of purines, thymidylic acid, and certain amino acids. While the functional dihydrofolate reductase gene has been mapped to chromosome 5, multiple intronless processed pseudogenes or dihydrofolate reductase-like genes have been identified on separate chromosomes. Dihydrofolate reductase deficiency has been linked to megaloblastic anemia. Several transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Dhfr Antibody is a mouse antibody against Dhfr. It can be used for Dhfr detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDihydrofolate reductase; EC 1.5.1.3; Dhfr
UniProt IDP17719
Protein RefseqThe length of the protein is 182 amino acids long.
The sequence is show below: MLRFNLIVAVCENFGIGIRGDLPWRIKSELKYFSRTTKRTSDPTKQNAVVMGRKTYFGVPESKRPLPDRLNIVLSTTLQESDLPKGVLLCPNLETAMKILEEQNEVENIWIVGGSGVYEEAMASPRCHRLYITKIMQKFDCDTFFPAIPDSFREVAPDSDMPLGVQEENGIKFEYKILEKHS.
For Research Use Only | Not For Clinical Use.
Online Inquiry