AibGenesis™ Mouse Anti-Dhfr Antibody (CBMOAB-14800FYA)
Cat: CBMOAB-14800FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-14800FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Yeast, Malaria parasite, Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO14800FYA | 100 µg | ||
| CBMOAB-40725FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO40725FYA | 100 µg | ||
| CBMOAB-73438FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO73438FYA | 100 µg | ||
| MO-AB-01588Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO01588Y | 100 µg | ||
| MO-AB-02971H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02971C | 100 µg | ||
| MO-AB-11412R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11412R | 100 µg | ||
| MO-AB-11857H | Monoclonal | Malaria parasite | WB, ELISA | MO11857C | 100 µg | ||
| MO-AB-25394H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25394C | 100 µg | ||
| MO-AB-26051W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26051W | 100 µg | ||
| MO-AB-43070W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43070W | 100 µg | ||
| MO-AB-54170W | Monoclonal | Marmoset | WB, ELISA | MO54170W | 100 µg | ||
| MO-NAB-00241W | Monoclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Yeast | WB, ELISA, IF, S-ELISA | 2B10 | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Yeast, Malaria parasite, Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO14800FYA |
| Specificity | This antibody binds to fruit fly Dhfr. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Dihydrofolate reductase converts dihydrofolate into tetrahydrofolate, a methyl group shuttle required for the de novo synthesis of purines, thymidylic acid, and certain amino acids. While the functional dihydrofolate reductase gene has been mapped to chromosome 5, multiple intronless processed pseudogenes or dihydrofolate reductase-like genes have been identified on separate chromosomes. Dihydrofolate reductase deficiency has been linked to megaloblastic anemia. Several transcript variants encoding different isoforms have been found for this gene. (From NCBI) |
| Product Overview | Mouse Anti-D. melanogaster Dhfr Antibody is a mouse antibody against Dhfr. It can be used for Dhfr detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Dihydrofolate reductase; EC 1.5.1.3; Dhfr |
| UniProt ID | P17719 |
| Protein Refseq | The length of the protein is 182 amino acids long. The sequence is show below: MLRFNLIVAVCENFGIGIRGDLPWRIKSELKYFSRTTKRTSDPTKQNAVVMGRKTYFGVPESKRPLPDRLNIVLSTTLQESDLPKGVLLCPNLETAMKILEEQNEVENIWIVGGSGVYEEAMASPRCHRLYITKIMQKFDCDTFFPAIPDSFREVAPDSDMPLGVQEENGIKFEYKILEKHS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry