Mouse Anti-DNAJC19 Antibody (CBMOAB-40980FYA)
Cat: CBMOAB-40980FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-40980FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO40980FYA | 100 µg | ||
| CBMOAB-73838FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO73838FYA | 100 µg | ||
| MO-AB-01914W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO01914W | 100 µg | ||
| MO-AB-03047H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03047C | 100 µg | ||
| MO-AB-11549R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11549R | 100 µg | ||
| MO-AB-13882W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13882W | 100 µg | ||
| MO-AB-25444H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25444C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO40980FYA |
| Specificity | This antibody binds to Rhesus DNAJC19. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is thought to be part of a complex involved in the ATP-dependent transport of transit peptide-containing proteins from the inner cell membrane to the mitochondrial matrix. Defects in this gene are a cause of 3-methylglutaconic aciduria type 5 (MGA5), also known as dilated cardiomyopathy with ataxia (DCMA). Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1, 2, 6, 10, 14 and 19. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus DNAJC19 Antibody is a mouse antibody against DNAJC19. It can be used for DNAJC19 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | DNAJC19 |
| UniProt ID | F7H8X5 |
| Protein Refseq | The length of the protein is 46 amino acids long. The sequence is show below: ASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSPYCQ. |
For Research Use Only | Not For Clinical Use.
Online Inquiry