Mouse Anti-Dog ABCC3 Antibody (MO-AB-28784W)


Cat: MO-AB-28784W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO28784W
SpecificityThis antibody binds to Dog ABCC3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined; however, this protein may play a role in the transport of biliary and intestinal excretion of organic anions. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.
Product OverviewMouse Anti-Dog ABCC3 Antibody is a mouse antibody against ABCC3. It can be used for ABCC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMultidrug resistance protein 3; ABCC3
UniProt IDQ38IV3
Protein RefseqThe length of the protein is 58 amino acids long.
The sequence is show below: ILAIYFLWQNLGPSILAGVAFMVLLIPLNGAVAVKMRAFQVEQMKFKDSRIKLMSEIL.
For Research Use Only | Not For Clinical Use.
Online Inquiry