Mouse Anti-Dog ABCC3 Antibody (MO-AB-28784W)
Cat: MO-AB-28784W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Dog (Canis lupus familiaris) |
Clone | MO28784W |
Specificity | This antibody binds to Dog ABCC3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined; however, this protein may play a role in the transport of biliary and intestinal excretion of organic anions. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. |
Product Overview | Mouse Anti-Dog ABCC3 Antibody is a mouse antibody against ABCC3. It can be used for ABCC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Multidrug resistance protein 3; ABCC3 |
UniProt ID | Q38IV3 |
Protein Refseq | The length of the protein is 58 amino acids long. The sequence is show below: ILAIYFLWQNLGPSILAGVAFMVLLIPLNGAVAVKMRAFQVEQMKFKDSRIKLMSEIL. |
See other products for " ABCC3 "
MO-AB-50200W | Mouse Anti-Marmoset ABCC3 Antibody (MO-AB-50200W) |
CBMOAB-1300FYC | Mouse Anti-Arabidopsis ABCC3 Antibody (CBMOAB-1300FYC) |
MO-AB-14616W | Mouse Anti-Chimpanzee ABCC3 Antibody (MO-AB-14616W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry