Mouse Anti-Dog ADORA2A Antibody (MO-AB-28841W)


Cat: MO-AB-28841W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO28841W
SpecificityThis antibody binds to Dog ADORA2A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor (GPCR) superfamily, which is subdivided into classes and subtypes. The receptors are seven-pass transmembrane proteins that respond to extracellular cues and activate intracellular signal transduction pathways. This protein, an adenosine receptor of A2A subtype, uses adenosine as the preferred endogenous agonist and preferentially interacts with the G(s) and G(olf) family of G proteins to increase intracellular cAMP levels. It plays an important role in many biological functions, such as cardiac rhythm and circulation, cerebral and renal blood flow, immune function, pain regulation, and sleep. It has been implicated in pathophysiological conditions such as inflammatory diseases and neurodegenerative disorders. Alternative splicing results in multiple transcript variants. A read-through transcript composed of the upstream SPECC1L (sperm antigen with calponin homology and coiled-coil domains 1-like) and ADORA2A (adenosine A2a receptor) gene sequence has been identified, but it is thought to be non-coding.
Product OverviewMouse Anti-Dog ADORA2A Antibody is a mouse antibody against ADORA2A. It can be used for ADORA2A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenosine receptor A2a; ADORA2A; RDC8
UniProt IDP11617
Protein RefseqThe length of the protein is 412 amino acids long.
The sequence is show below: MSTMGSWVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHNCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAVCWVLSFAIGLTPMLGWNNCSQPKEGRNYSQGCGEGQVACLFEDVVPMNYMVYYNFFAFVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPECSHAPLWLMYLTIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRRREPFKAGGTSARALAAHGSDGEQISLRLNGHPPGVWANGSAPHPERRPNGYTLGLVSGGIAPESHGDMGLPDVELLSHELKGACPESPGLEGPLAQDGAGVS.
For Research Use Only | Not For Clinical Use.
Online Inquiry