Mouse Anti-Dog ANXA9 Antibody (MO-AB-28971W)


Cat: MO-AB-28971W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO28971W
SpecificityThis antibody binds to Dog ANXA9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Plasma membrane; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe annexins are a family of calcium-dependent phospholipid-binding proteins. Members of the annexin family contain 4 internal repeat domains, each of which includes a type II calcium-binding site. The calcium-binding sites are required for annexins to aggregate and cooperatively bind anionic phospholipids and extracellular matrix proteins. This gene encodes a divergent member of the annexin protein family in which all four homologous type II calcium-binding sites in the conserved tetrad core contain amino acid substitutions that ablate their function. However, structural analysis suggests that the conserved putative ion channel formed by the tetrad core is intact.
Product OverviewMouse Anti-Dog ANXA9 Antibody is a mouse antibody against ANXA9. It can be used for ANXA9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAnnexin; ANXA9
UniProt IDE2RQ29
Protein RefseqThe length of the protein is 349 amino acids long.
The sequence is show below: MSVTSGKTRPSLTQEILSHLGLANKTAAWGTLGTLRTFLSFSVDKDVQRLLRAIAGQGVDCSAIMGVLTNRTREQRQLICRAFQERTQQDLLKSLQAALSGNLERIVIALLQSAAQFDAQELRTALKNSGPAEDVALEILATRSAPHLQECLTVYKQNFQVEAEEDIKSETSDILQELLLALAKGVRDRYSGIIDYNLVEQDVQALKQAEAPSTEGTWVLIFTQRNLEHLIRDTIQVFDQYQRCTGHELEKTVQNRFHGDAQAALLSLASVIKNTPLYFADKLHQALQDIKPNYQVLMRILISRSETDLLSIRAEFKKKFGKSLYSSLQDAVKGDCRSALLALCRGEDI.
For Research Use Only | Not For Clinical Use.
Online Inquiry