Mouse Anti-Dog apM1 Antibody (MO-AB-28988W)


Cat: MO-AB-28988W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO28988W
SpecificityThis antibody binds to Dog apM1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the adaptor complexes which link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration. The AP-1 complex interacts directly with clathrin. AP57 is probably a subunit of the Golgi membrane adaptor.
Product OverviewMouse Anti-Dog apM1 Antibody is a mouse antibody against apM1. It can be used for apM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdiponectin; apM1
UniProt IDQ76C76
Protein RefseqThe length of the protein is 244 amino acids long.
The sequence is show below: MLLLRAVLLLLVLPAHGQDSVAEGPGVLLPLPKGACPGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLVGPKGDTGETGVTGVEGPRGFPGTPCRKGEPGESAYVHRSAFSVGLESRITVPNVPIRFTKIFYNLQNHYDGTTGKFHCNIPGLYYFSYHITVYLKDVKVSLYKKDKAMLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDSYGIYADNVNDSTFTGFLLYHDTN.
For Research Use Only | Not For Clinical Use.
Online Inquiry