Mouse Anti-Dog APOH Antibody (MO-AB-29000W)


Cat: MO-AB-29000W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO29000W
SpecificityThis antibody binds to Dog APOH.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionApolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome, but it does not seem to be required for the reactivity of antiphospholipid autoantibodies associated with infections.
Product OverviewMouse Anti-Dog APOH Antibody is a mouse antibody against APOH. It can be used for APOH detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBeta-2-glycoprotein 1; Apolipoprotein H; Apo-H; Beta-2-glycoprotein I; B2GPI; Beta(2)GPI; APOH
UniProt IDP33703
Protein RefseqThe length of the protein is 345 amino acids long.
The sequence is show below: MISLGLILFSSVLCHVATAGRTCPKPDDIPFATVVPLKTFYDPGEQIAYTCQPGYVFRGLTRRFTCPLTGVWPTNTVRCIPRVCPFAGILENGAVRYTTFEYPNTISFACNTGFYLNGSSSAKCTEEGKWSVDLPVCTRVTCPPPSVPKFATLSVFKPLATNNSLYGNKAVFECLPHYAMFGNDTITCTAHGNWTTLPECREVKCPFPSRPDNGFVNYPAKQILYYKDKAMYGCHDTYTLDGPEVVECNKFGNWSAQPSCKASCKLSVKKATVLYQGERVKLQEKFKDGMLHGQKVSFYCKNKEKKCSYTEDAECIDGTIEIPKCFKEHSSLAFWKTDASDVKPC.
For Research Use Only | Not For Clinical Use.
Online Inquiry