Mouse Anti-Dog BDKRB1 Antibody (MO-AB-29233W)


Cat: MO-AB-29233W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO29233W
SpecificityThis antibody binds to Dog BDKRB1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionBradykinin, a 9 aa peptide, is generated in pathophysiologic conditions such as inflammation, trauma, burns, shock, and allergy. Two types of G-protein coupled receptors have been found which bind bradykinin and mediate responses to these pathophysiologic conditions. The protein encoded by this gene is one of these receptors and is synthesized de novo following tissue injury. Receptor binding leads to an increase in the cytosolic calcium ion concentration, ultimately resulting in chronic and acute inflammatory responses. Several transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Dog BDKRB1 Antibody is a mouse antibody against BDKRB1. It can be used for BDKRB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesB1 bradykinin receptor; B1R; BK-1 receptor; BDKRB1
UniProt IDQ9BDQ5
Protein RefseqThe length of the protein is 350 amino acids long.
The sequence is show below: MASRAPLELLPLNRSQLSPPNATTCDDAPEAWDLLHRVLPSVIIIICVCGLLGNLLVLAVLLRPRRRLNVAEMYLANLAASDLVFVLGLPFWAANISNQFRWPFGGLLCRLVNGVIKANLFISIFLVVAISRDRYRALVHPMATRRRRQARATCVLIWVAGSLLSVPTFLFRSIEAVPELNNDSACVLLHPPGAWHVARMVELNVLGFLLPLAAIVFFNCHILASLRGRPEVRGARCGGPPDGRTTALILTFVAAFLVCWTPYHFFAFLEFLTQVQVVRGCFWENFKDLGLQYASFFAFINSCLNPVIYVFVGRLFRTRVWDLFKQCAPRRPPAVSWSHRKRVLQLFWQN.
For Research Use Only | Not For Clinical Use.
Online Inquiry