Mouse Anti-Dog CCL4 Antibody (MO-AB-29416W)


Cat: MO-AB-29416W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO29416W
SpecificityThis antibody binds to Dog CCL4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCL4 (C-C Motif Chemokine Ligand 4) is a Protein Coding gene. Diseases associated with CCL4 include Pulmonary Tuberculosis and Meningitis. Among its related pathways are PEDF Induced Signaling and Cytokine Signaling in Immune system. Gene Ontology (GO) annotations related to this gene include identical protein binding and chemokine activity. An important paralog of this gene is CCL4L2.
Product OverviewMouse Anti-Dog CCL4 Antibody is a mouse antibody against CCL4. It can be used for CCL4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-C motif chemokine; LOC480600
UniProt IDE2RA85
Protein RefseqThe length of the protein is 93 amino acids long.
The sequence is show below: MEVSTAALAVLLLIAALCSQTCSSTFGADTPTSCCFSYISRQIPRKFVVDYYETSSQCSKPGVIFQTKRGQQICADPGKAWVQKYITNLELNA.
For Research Use Only | Not For Clinical Use.
Online Inquiry