Mouse Anti-Dog CNR1 Antibody (MO-AB-29627W)


Cat: MO-AB-29627W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO29627W
SpecificityThis antibody binds to Dog CNR1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCNR1 (Cannabinoid Receptor 1) is a Protein Coding gene. Diseases associated with CNR1 include Cannabis Dependence and Anxiety. Among its related pathways are N-cadherin signaling events and Cell-type Dependent Selectivity of CCK2R Signaling. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity and cannabinoid receptor activity. An important paralog of this gene is CNR2.
Product OverviewMouse Anti-Dog CNR1 Antibody is a mouse antibody against CNR1. It can be used for CNR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCannabinoid receptor 1; CNR1
UniProt IDQ9BFC5
Protein RefseqThe length of the protein is 330 amino acids long.
The sequence is show below: FRGSPFQEKMTAGDNAQLVPADQVNITEFYNKSLSSYKENEENIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFC.
For Research Use Only | Not For Clinical Use.
Online Inquiry